HPA018467

IL16 antibody from Sigma-Aldrich
FLJ16806, FLJ42735, HsT19289, IL-16, LCF, prIL-16
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018467
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018467, RRID:AB_1851642
Product name
Anti-IL16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018467
Antibody type
Polyclonal
Antigen
Interleukin-16 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSS
AVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNED
SAANGSAETSALDTGFSLNLSELREYTEGLTEAKE
DDDG
Storage
-20C
Provider Type Product Number
- No reagents -