Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310853 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Reticulon 4 (RTN4) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELV
QKYSN SALGHVNCTI- Vial size
- 50 µg
Submitted references A spastic paraplegia mouse model reveals REEP1-dependent ER shaping.
The N-terminal domain of Nogo-A inhibits cell adhesion and axonal outgrowth by an integrin-specific mechanism.
Beetz C, Koch N, Khundadze M, Zimmer G, Nietzsche S, Hertel N, Huebner AK, Mumtaz R, Schweizer M, Dirren E, Karle KN, Irintchev A, Alvarez V, Redies C, Westermann M, Kurth I, Deufel T, Kessels MM, Qualmann B, Hübner CA
The Journal of clinical investigation 2013 Oct;123(10):4273-82
The Journal of clinical investigation 2013 Oct;123(10):4273-82
The N-terminal domain of Nogo-A inhibits cell adhesion and axonal outgrowth by an integrin-specific mechanism.
Hu F, Strittmatter SM
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Jan 30;28(5):1262-9
The Journal of neuroscience : the official journal of the Society for Neuroscience 2008 Jan 30;28(5):1262-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting