Antibody data

Product number
H00007412-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007412-M04, RRID:AB_1579884
Product name
VCAM1 monoclonal antibody (M04), clone 1H6
Provider product page
Abnova Corporation - H00007412-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant VCAM1.
Antigen sequence
MPGKMVVILGASNILWIMFAASQAFKIETTPESRY
LAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGK
VTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLE
KGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVA
DVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLET
KSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTV
RQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMT
CSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIA
MRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTV
EISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQ
IDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTV
TCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLED
TDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHID
DMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILE
EGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSE
NATLTLISTKMEDSGVYLCEGINQAGRSRKEVELI
IQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPE
TWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGV
YECESKNKVGSQLRSLTLDVQGRENNKDYFSPELL
VLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQ
KSKV
Isotype
IgG
Antibody clone number
1H6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -