Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184358 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-TATA Box Binding Protein (TBP) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TBP antibody: synthetic peptide directed towards the middle region of human TBP
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPA
KFLDF KIQNMVGSCD- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references TBP, a polyglutamine tract containing protein, accumulates in Alzheimer's disease.
Central-type benzodiazepines modulate GABAA receptor chloride channels in cultured pituitary melanotrophs.
Reid SJ, van Roon-Mom WM, Wood PC, Rees MI, Owen MJ, Faull RL, Dragunow M, Snell RG
Brain research. Molecular brain research 2004 Jun 18;125(1-2):120-8
Brain research. Molecular brain research 2004 Jun 18;125(1-2):120-8
Central-type benzodiazepines modulate GABAA receptor chloride channels in cultured pituitary melanotrophs.
Louiset E, Valentijn JA, Vaudry H, Cazin L
Brain research. Molecular brain research 1992 Jan;12(1-3):1-6
Brain research. Molecular brain research 1992 Jan;12(1-3):1-6
No comments: Submit comment
No validations: Submit validation data