HPA000755

ZBTB33 antibody from Sigma-Aldrich
kaiso, WUGSC:H_DJ525N14.1, ZNF-kaiso, ZNF348
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000755
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000755, RRID:AB_1079167
Product name
Anti-ZBTB33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000755
Antibody type
Polyclonal
Antigen
Transcriptional regulator Kaiso recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IAELGVPLSQVKSISGTAQDGNTEPLPPDSGDKNL
VIQKSKDEAQDNGATIMPIITESFSLSAEDYEMKK
IIVTDSDDDDDDVIFCSEILPTKETLPSNNTVAQV
QSNPGPVAISD
Storage
-20C
Provider Type Product Number
- No reagents -