Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183466 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-T-Bet (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the C terminal of mouse TBX21
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGE
GDTKR RRISPYPSSG- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Zinc-finger genes Fez and Fez-like function in the establishment of diencephalon subdivisions.
Zinc-finger gene Fez in the olfactory sensory neurons regulates development of the olfactory bulb non-cell-autonomously.
Hirata T, Nakazawa M, Muraoka O, Nakayama R, Suda Y, Hibi M
Development (Cambridge, England) 2006 Oct;133(20):3993-4004
Development (Cambridge, England) 2006 Oct;133(20):3993-4004
Zinc-finger gene Fez in the olfactory sensory neurons regulates development of the olfactory bulb non-cell-autonomously.
Hirata T, Nakazawa M, Yoshihara S, Miyachi H, Kitamura K, Yoshihara Y, Hibi M
Development (Cambridge, England) 2006 Apr;133(8):1433-43
Development (Cambridge, England) 2006 Apr;133(8):1433-43
No comments: Submit comment
No validations: Submit validation data