Antibody data

Product number
ABIN632492
Provider
antibodies-online
Product name
anti-Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A) antibody
Provider product page
antibodies-online - ABIN632492
Antibody type
Polyclonal
Antigen
ADH1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA
Description
Affinity purified
Reactivity
Human
Host
Rabbit
Vial size
50 μg
Concentration
1 mg/mL
Storage
Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling
Avoid repeated freeze/thaw cycles.
Provider Type Product Number
- No reagents -