Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310272 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SERPINB5 antibody: synthetic peptide directed towards the middle region of human SERPINB5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPF
RLNKT DTKPVQMMNM- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cancer cell resistance to aurora kinase inhibitors: identification of novel targets for cancer therapy.
SERPINB5 and AKAP12 - expression and promoter methylation of metastasis suppressor genes in pancreatic ductal adenocarcinoma.
Decreased immunoreactive maspin expression in intermediate thickness and thick primary melanoma lesions.
Hrabakova R, Kollareddy M, Tyleckova J, Halada P, Hajduch M, Gadher SJ, Kovarova H
Journal of proteome research 2013 Jan 4;12(1):455-69
Journal of proteome research 2013 Jan 4;12(1):455-69
SERPINB5 and AKAP12 - expression and promoter methylation of metastasis suppressor genes in pancreatic ductal adenocarcinoma.
Mardin WA, Petrov KO, Enns A, Senninger N, Haier J, Mees ST
BMC cancer 2010 Oct 12;10:549
BMC cancer 2010 Oct 12;10:549
Decreased immunoreactive maspin expression in intermediate thickness and thick primary melanoma lesions.
Vereecken P, Reynaert S, Lalmand MC, Zouaoui-Boudjeltia K, Heenen M, Van Den Heule B, Petein M
The Journal of international medical research 2006 Jan-Feb;34(1):52-7
The Journal of international medical research 2006 Jan-Feb;34(1):52-7
No comments: Submit comment
No validations: Submit validation data