Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182902 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kinesin Family Member 5B (KIF5B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KIF5B antibody: synthetic peptide directed towards the N terminal of human KIF5B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVI
ASKPY AFDRVFQSST- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Autophagy is increased in prostate cancer cells overexpressing acid ceramidase and enhances resistance to C6 ceramide.
The ribosome receptor, p180, interacts with kinesin heavy chain, KIF5B.
Turner LS, Cheng JC, Beckham TH, Keane TE, Norris JS, Liu X
Prostate cancer and prostatic diseases 2011 Mar;14(1):30-7
Prostate cancer and prostatic diseases 2011 Mar;14(1):30-7
The ribosome receptor, p180, interacts with kinesin heavy chain, KIF5B.
Diefenbach RJ, Diefenbach E, Douglas MW, Cunningham AL
Biochemical and biophysical research communications 2004 Jul 2;319(3):987-92
Biochemical and biophysical research communications 2004 Jul 2;319(3):987-92
No comments: Submit comment
No validations: Submit validation data