Antibody data

Product number
H00002960-M07A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002960-M07A, RRID:AB_1137243
Product name
GTF2E1 monoclonal antibody (M07A), clone 1E12
Provider product page
Abnova Corporation - H00002960-M07A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GTF2E1.
Antigen sequence
SCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCR
MRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHM
RRRIETDERDSTNRASFKCPVCSSTFTDLE
Isotype
IgM
Antibody clone number
1E12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -