HPA002076

PCNXL4 antibody from Atlas Antibodies
C14orf135
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA002076
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002076, RRID:AB_611968
Product name
Anti-PCNXL4
Provider product page
Atlas Antibodies - HPA002076
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELIKYLEEYERDWYIGLVSDEKWKEAILQEKPYLF
SLGYDSNMGIYTGRVLSLQELLIQVGKLNPEAVRG
QWANLSWELLYATNDDEERYSIQAHPLLLRNLTVQ
AAEPPLGYPIYSSKPLHIHLY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -