HPA002076

PCNXL4 antibody from Sigma-Aldrich
C14orf135
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002076
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002076, RRID:AB_1078322
Product name
Anti-C14orf135 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002076
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf135 precursor (Hepatitis C virus F protein-binding protein 2) (HCV F protein-binding protein 2)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELIKYLEEYERDWYIGLVSDEKWKEAILQEKPYLF
SLGYDSNMGIYTGRVLSLQELLIQVGKLNPEAVRG
QWANLSWELLYATNDDEERYSIQAHPLLLRNLTVQ
AAEPPLGYPIYSSKPLHIHLY
Storage
-20C
Provider Type Product Number
- No reagents -