Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503545 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEH
NKAHA QLVREVDVEK- Vial size
- 50 µg
Submitted references Phosphodiesterase 8B gene variants are associated with serum TSH levels and thyroid function.
Arnaud-Lopez L, Usala G, Ceresini G, Mitchell BD, Pilia MG, Piras MG, Sestu N, Maschio A, Busonero F, Albai G, Dei M, Lai S, Mulas A, Crisponi L, Tanaka T, Bandinelli S, Guralnik JM, Loi A, Balaci L, Sole G, Prinzis A, Mariotti S, Shuldiner AR, Cao A, Schlessinger D, Uda M, Abecasis GR, Nagaraja R, Sanna S, Naitza S
American journal of human genetics 2008 Jun;82(6):1270-80
American journal of human genetics 2008 Jun;82(6):1270-80
No comments: Submit comment
No validations: Submit validation data