HPA001048

BMX antibody from Sigma-Aldrich
ETK, PSCTK3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001048
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001048, RRID:AB_1078289
Product name
Anti-BMX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001048
Antibody type
Polyclonal
Antigen
Cytoplasmic tyrosine-protein kinase BMX recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRV
PTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNES
KKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQ
YIPREDFPDWWQVR
Storage
-20C
Provider Type Product Number
- No reagents -