H00009306-M01

SOCS6 antibody from Abnova Corporation
CIS4, Cish4, HSPC060, SOCS4, SSI4, STAI4, STATI4

Antibody data

Product number
H00009306-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009306-M01, RRID:AB_425802
Product name
SOCS6 monoclonal antibody (M01), clone M2-F12
Provider product page
Abnova Corporation - H00009306-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant SOCS6.
Antigen sequence
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASD
FGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKS
ESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFS
SSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLR
PTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDF
HDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVP
VVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSS
SPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIF
VDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLP
PMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNS
APGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWY
WGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIV
DLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNP
VSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNK
MKDYLQEKHY
Isotype
IgG
Antibody clone number
M2-F12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -