Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003082-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003082-A01, RRID:AB_529822
- Product name
- HGF polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HGF.
- Antigen sequence
YTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLN
ESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVL
GVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTY
KVPQS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Analysis of growth factor expression in affected and unaffected muscles of oculo-pharyngeal muscular dystrophy (OPMD) patients: a pilot study.
Bouazza B, Kratassiouk G, Gjata B, Perie S, Lacau St Guily J, Butler-Browne GS, Svinartchouk F
Neuromuscular disorders : NMD 2009 Mar;19(3):199-206
Neuromuscular disorders : NMD 2009 Mar;19(3):199-206
No comments: Submit comment
No validations: Submit validation data