HPA015774

TNNT2 antibody from Atlas Antibodies
CMD1D, CMH2, CMPD2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015774
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015774, RRID:AB_1858354
Product name
Anti-TNNT2
Provider product page
Atlas Antibodies - HPA015774
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEEENRRKAEDEARKKKALSNMMHFGGYIQKQAQT
ERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQL
REKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVL
RNRINDNQKVSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -