HPA027574

RCC1 antibody from Sigma-Aldrich
CHC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027574
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027574, RRID:AB_10601236
Product name
Anti-RCC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027574
Antibody type
Polyclonal
Antigen
regulator of chromosome condensation 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWG
SFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVAS
GNDHLVM
Storage
-20C
Provider Type Product Number
- No reagents -