Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183539 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glypican 3 (GPC3) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GPC3 antibody: synthetic peptide directed towards the middle region of human GPC3
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYR
SAYYP EDLFIDKKVL- Vial size
- 0.1 mg
Submitted references Regulation of liver growth by glypican 3, CD81, hedgehog, and Hhex.
Methylation analysis of the glypican 3 gene in embryonal tumours.
Bhave VS, Mars W, Donthamsetty S, Zhang X, Tan L, Luo J, Bowen WC, Michalopoulos GK
The American journal of pathology 2013 Jul;183(1):153-9
The American journal of pathology 2013 Jul;183(1):153-9
Methylation analysis of the glypican 3 gene in embryonal tumours.
Boily G, Saikali Z, Sinnett D
British journal of cancer 2004 Apr 19;90(8):1606-11
British journal of cancer 2004 Apr 19;90(8):1606-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry