Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502039 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-IMP3, U3 Small Nucleolar Ribonucleoprotein, Homolog (Yeast) (IMP3) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IMP3 antibody: synthetic peptide directed towards the middle region of human IMP3
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKR
HVLEY NEERDDFDLE- Vial size
- 50 µg
Submitted references [Comparison of 3 hand-carried ultrasound devices with comprehensive echocardiographic devices in elderly cardiac inpatient examinations].
The oncofetal protein IMP3: a novel biomarker for endometrial serous carcinoma.
Ma J, Jin XF, Liu Y, Yang L, Zheng JH, Zhang YH, Miao AY, Chen M
Zhongguo yi liao qi xie za zhi = Chinese journal of medical instrumentation 2008 Jul;32(4):304-7
Zhongguo yi liao qi xie za zhi = Chinese journal of medical instrumentation 2008 Jul;32(4):304-7
The oncofetal protein IMP3: a novel biomarker for endometrial serous carcinoma.
Zheng W, Yi X, Fadare O, Liang SX, Martel M, Schwartz PE, Jiang Z
The American journal of surgical pathology 2008 Feb;32(2):304-15
The American journal of surgical pathology 2008 Feb;32(2):304-15
No comments: Submit comment
No validations: Submit validation data