Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182990 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Enolase 1, (Alpha) (ENO1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY
KSFIK DYPVVSIEDP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Novel immunohistochemical marker, integrin α(V)β(3), for BOP-induced early lesions in hamster pancreatic ductal carcinogenesis.
Frontal-subcortical protein expression following prenatal exposure to maternal inflammation.
Proteins upregulated by mild and severe hypoxia in squamous cell carcinomas in vitro identified by proteomics.
Hypoxia influences the cellular cross-talk of human dermal fibroblasts. A proteomic approach.
Human alpha-enolase from endothelial cells as a target antigen of anti-endothelial cell antibody in Behçet's disease.
Kitahashi T, Yoshimoto M, Imai T
Oncology letters 2011 Mar;2(2):229-234
Oncology letters 2011 Mar;2(2):229-234
Frontal-subcortical protein expression following prenatal exposure to maternal inflammation.
Deng MY, Lam S, Meyer U, Feldon J, Li Q, Wei R, Luk L, Chua SE, Sham P, Wang Y, McAlonan GM
PloS one 2011 Feb 10;6(2):e16638
PloS one 2011 Feb 10;6(2):e16638
Proteins upregulated by mild and severe hypoxia in squamous cell carcinomas in vitro identified by proteomics.
Sørensen BS, Horsman MR, Vorum H, Honoré B, Overgaard J, Alsner J
Radiotherapy and oncology : journal of the European Society for Therapeutic Radiology and Oncology 2009 Sep;92(3):443-9
Radiotherapy and oncology : journal of the European Society for Therapeutic Radiology and Oncology 2009 Sep;92(3):443-9
Hypoxia influences the cellular cross-talk of human dermal fibroblasts. A proteomic approach.
Boraldi F, Annovi G, Carraro F, Naldini A, Tiozzo R, Sommer P, Quaglino D
Biochimica et biophysica acta 2007 Nov;1774(11):1402-13
Biochimica et biophysica acta 2007 Nov;1774(11):1402-13
Human alpha-enolase from endothelial cells as a target antigen of anti-endothelial cell antibody in Behçet's disease.
Lee KH, Chung HS, Kim HS, Oh SH, Ha MK, Baik JH, Lee S, Bang D
Arthritis and rheumatism 2003 Jul;48(7):2025-35
Arthritis and rheumatism 2003 Jul;48(7):2025-35
No comments: Submit comment
No validations: Submit validation data