Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079923-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079923-M01, RRID:AB_534949
- Product name
- NANOG monoclonal antibody (M01), clone 2C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NANOG.
- Antigen sequence
TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNIL
NLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQ
KASAPTYPSLYSSYHQGCLVNPTGNLPM- Isotype
- IgG
- Antibody clone number
- 2C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Nanog1 in NTERA-2 and recombinant NanogP8 from somatic cancer cells adopt multiple protein conformations and migrate at multiple M.W species.
Transcriptional properties of human NANOG1 and NANOG2 in acute leukemic cells.
Liu B, Badeaux MD, Choy G, Chandra D, Shen I, Jeter CR, Rycaj K, Lee CF, Person MD, Liu C, Chen Y, Shen J, Jung SY, Qin J, Tang DG
PloS one 2014;9(3):e90615
PloS one 2014;9(3):e90615
Transcriptional properties of human NANOG1 and NANOG2 in acute leukemic cells.
Eberle I, Pless B, Braun M, Dingermann T, Marschalek R
Nucleic acids research 2010 Sep;38(16):5384-95
Nucleic acids research 2010 Sep;38(16):5384-95
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NANOG monoclonal antibody (M01), clone 2C11 Western Blot analysis of NANOG expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NANOG is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
