Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN616885 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nanog Homeobox (NANOG) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NANOG antibody: synthetic peptide directed towards the middle region of human NANOG
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKA
SAPTY PSLYSSYHQG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Nocodazole treatment decreases expression of pluripotency markers Nanog and Oct4 in human embryonic stem cells.
Opposing putative roles for canonical and noncanonical NFκB signaling on the survival, proliferation, and differentiation potential of human embryonic stem cells.
Expression and functional analysis of G1 to S regulatory components reveals an important role for CDK2 in cell cycle regulation in human embryonic stem cells.
Activation of p53 by nutlin leads to rapid differentiation of human embryonic stem cells.
Kallas A, Pook M, Maimets M, Zimmermann K, Maimets T
PloS one 2011 Apr 29;6(4):e19114
PloS one 2011 Apr 29;6(4):e19114
Opposing putative roles for canonical and noncanonical NFκB signaling on the survival, proliferation, and differentiation potential of human embryonic stem cells.
Yang C, Atkinson SP, Vilella F, Lloret M, Armstrong L, Mann DA, Lako M
Stem cells (Dayton, Ohio) 2010 Nov;28(11):1970-80
Stem cells (Dayton, Ohio) 2010 Nov;28(11):1970-80
Expression and functional analysis of G1 to S regulatory components reveals an important role for CDK2 in cell cycle regulation in human embryonic stem cells.
Neganova I, Zhang X, Atkinson S, Lako M
Oncogene 2009 Jan 8;28(1):20-30
Oncogene 2009 Jan 8;28(1):20-30
Activation of p53 by nutlin leads to rapid differentiation of human embryonic stem cells.
Maimets T, Neganova I, Armstrong L, Lako M
Oncogene 2008 Sep 11;27(40):5277-87
Oncogene 2008 Sep 11;27(40):5277-87
No comments: Submit comment
No validations: Submit validation data