Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1545520 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Breast Cancer 1 (BRCA1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the N terminal of human BRCA1
- Description
- Affinity Purified
- Reactivity
- Human, Rat, Canine
- Host
- Rabbit
- Antigen sequence
MDLSALRVEEVQNVINAMQKILECPICLELIKEPV
STKCD HIFCKFCMLK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Lymphocyte infiltration, expression of interleukin (IL) -1, IL-6 and expression of mutated breast cancer susceptibility gene-1 correlate with malignancy of canine mammary tumours.
Characterization of segments from the central region of BRCA1: an intrinsically disordered scaffold for multiple protein-protein and protein-DNA interactions?
Kim JH, Yu CH, Yhee JY, Im KS, Sur JH
Journal of comparative pathology 2010 Feb-Apr;142(2-3):177-86
Journal of comparative pathology 2010 Feb-Apr;142(2-3):177-86
Characterization of segments from the central region of BRCA1: an intrinsically disordered scaffold for multiple protein-protein and protein-DNA interactions?
Mark WY, Liao JC, Lu Y, Ayed A, Laister R, Szymczyna B, Chakrabartty A, Arrowsmith CH
Journal of molecular biology 2005 Jan 14;345(2):275-87
Journal of molecular biology 2005 Jan 14;345(2):275-87
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Antibody Titration: 0.2-1 μg/mL Positive Control: K562BRCA1 is supported by BioGPS gene expression data to be expressed in K562