HPA002806

CXorf36 antibody from Sigma-Aldrich
DIA1R, FLJ14103
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002806
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002806, RRID:AB_1078595
Product name
Anti-CXorf36 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002806
Antibody type
Polyclonal
Antigen
Uncharacterized protein CXorf36 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLPASSLSSLVPQVRTSYNFGRTFLGLDKCNACIG
TSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPAN
YSDDSKIWRPVEIFRLVSKYQNEISDRRICASASA
PKTCSIERVLRKTERFQKWLQAKRLTPDL
Storage
-20C
Provider Type Product Number
- No reagents -