ABIN184015
antibody from antibodies-online
Targeting: SRSF1
ASF, MGC5228, SF2, SF2p33, SFRS1, SRp30a
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184015 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-serine/arginine-Rich Splicing Factor 1 (SRSF1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the C terminal of human SFRS1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVD
GPRSP SYGRSRSRSR- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A strategy to rapidly identify the functional targets of microRNAs by combining bioinformatics and mRNA cytoplasmic/nucleic ratios in culture cells.
Mass spectrometric and kinetic analysis of ASF/SF2 phosphorylation by SRPK1 and Clk/Sty.
Li J, Xia W, Huang B, Chen L, Su X, Li S, Wang F, Ding H, Shao N
FEBS letters 2010 Jul 16;584(14):3198-202
FEBS letters 2010 Jul 16;584(14):3198-202
Mass spectrometric and kinetic analysis of ASF/SF2 phosphorylation by SRPK1 and Clk/Sty.
Velazquez-Dones A, Hagopian JC, Ma CT, Zhong XY, Zhou H, Ghosh G, Fu XD, Adams JA
The Journal of biological chemistry 2005 Dec 16;280(50):41761-8
The Journal of biological chemistry 2005 Dec 16;280(50):41761-8
No comments: Submit comment
No validations: Submit validation data