Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406748 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Caveolin 2 (CAV2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CAV2 antibody: synthetic peptide directed towards the N terminal of human CAV2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ
NNYGL ASFKSFLKSE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references DLK1: a novel target for immunotherapeutic remodeling of the tumor blood vasculature.
Serine 23 and 36 phosphorylation of caveolin-2 is differentially regulated by targeting to lipid raft/caveolae and in mitotic endothelial cells.
Chi Sabins N, Taylor JL, Fabian KP, Appleman LJ, Maranchie JK, Stolz DB, Storkus WJ
Molecular therapy : the journal of the American Society of Gene Therapy 2013 Oct;21(10):1958-68
Molecular therapy : the journal of the American Society of Gene Therapy 2013 Oct;21(10):1958-68
Serine 23 and 36 phosphorylation of caveolin-2 is differentially regulated by targeting to lipid raft/caveolae and in mitotic endothelial cells.
Sowa G, Xie L, Xu L, Sessa WC
Biochemistry 2008 Jan 8;47(1):101-11
Biochemistry 2008 Jan 8;47(1):101-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Sample Type: Human placental tissue Primary Antibody Dilution: 1:50Secondary Antibody: Goat anti rabbit-HRP Secondary Antibody Dilution: 1:00,000Color/Signal Descriptions: Brown: CAV2Purple: Haemotoxylin Gene Name: CAV2 Submitted by: Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham