Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30633 - Provider product page
- Provider
- Abnova Corporation
- Product name
- FAM50A polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant human FAM50A.
- Antigen sequence
VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLE
KLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEA
AMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDR
E- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: human plasma (IgG/HSA depleted), Lane 4: human liver and Lane 5: human tonsil lysates with FAM50A polyclonal antibody (Cat # PAB30633).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with FAM50A polyclonal antibody (Cat # PAB30633).