HPA037509

POC5 antibody from Atlas Antibodies
C5orf37, FLJ35779, hPOC5, MGC120442, MGC120443, MGC120444

Antibody data

Product number
HPA037509
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037509, RRID:AB_2797227
Product name
Anti-POC5
Provider product page
Atlas Antibodies - HPA037509
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KWEEYEELLHYAIVTPNIEPCASQSSHPKGELVPD
VRISTIHDILHSQGNNSEVRETAIEVGKGCDFHIS
SHSKTDESSPVLSPRKPSHPVMD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -