ABIN567547

UBL4A antibody from antibodies-online
DXS254E, GDX, GET5, MDY2, TMA24, UBL4

Antibody data

Product number
ABIN567547
Provider
antibodies-online
Product name
anti-Ubiquitin-Like 4A (UBL4A) (Middle Region) antibody
Provider product page
antibodies-online - ABIN567547
Antibody type
Polyclonal
Antigen
The immunogen for anti-UBL4A antibody: synthetic peptide directed towards the middle region of human UBL4A
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
EGEAQRLADSPPPQVWQLISKVLARHFSAADASRV
LEQLQ RDYERSLSRL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -