HPA036259

NXPE3 antibody from Atlas Antibodies
FAM55C, MGC15606
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA036259
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036259, RRID:AB_10671838
Product name
Anti-NXPE3
Provider product page
Atlas Antibodies - HPA036259
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EFNLGSPKNVGPFLAVDQKHNILLKYRCHGPPIRF
TTVFSNELHYVANELNGIVGGKNTVVAIAVWSHFS
TFPLEVYIRRLRNIRRAVVRLLDRSPKTVVVIRTA
NAQELGPEVSLFNSDWYNFQLDTILRRMFSGVGVY
LVDA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -