Antibody data

Product number
ABIN502716
Provider
antibodies-online
Product name
anti-Valyl-tRNA Synthetase (VARS) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502716
Antibody type
Polyclonal
Antigen
The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLE
AISIM DSRGALINVP
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -