Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502716 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Valyl-tRNA Synthetase (VARS) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLE
AISIM DSRGALINVP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Defective valyl-tRNA synthetase hampers the mitochondrial respiratory chain in Neurospora crassa.
Large-scale mapping of human protein-protein interactions by mass spectrometry.
Duarte M, Videira A
The Biochemical journal 2012 Dec 15;448(3):297-306
The Biochemical journal 2012 Dec 15;448(3):297-306
Large-scale mapping of human protein-protein interactions by mass spectrometry.
Ewing RM, Chu P, Elisma F, Li H, Taylor P, Climie S, McBroom-Cerajewski L, Robinson MD, O'Connor L, Li M, Taylor R, Dharsee M, Ho Y, Heilbut A, Moore L, Zhang S, Ornatsky O, Bukhman YV, Ethier M, Sheng Y, Vasilescu J, Abu-Farha M, Lambert JP, Duewel HS, Stewart II, Kuehl B, Hogue K, Colwill K, Gladwish K, Muskat B, Kinach R, Adams SL, Moran MF, Morin GB, Topaloglou T, Figeys D
Molecular systems biology 2007;3:89
Molecular systems biology 2007;3:89
No comments: Submit comment
No validations: Submit validation data