HPA024704

GFRA2 antibody from Sigma-Aldrich
GDNFRB, NTNRA, RETL2, TRNR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024704
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024704, RRID:AB_1849629
Product name
Anti-GFRA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024704
Antibody type
Polyclonal
Antigen
GDNF family receptor alpha-2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSR
YRTLRQCLAGRDRNTMLANKECQAALEVLQESPLY
DCR
Storage
-20C
Provider Type Product Number
- No reagents -