H00010072-M01A

DPP3 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00010072-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010072-M01A, RRID:AB_1204281
Product name
DPP3 monoclonal antibody (M01A), clone 4D3
Provider product page
Abnova Corporation - H00010072-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DPP3.
Antigen sequence
LTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSG
KLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGE
TWDSKFSTIAS
Isotype
IgM
Antibody clone number
4D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -