HPA003356

HYPM antibody from Sigma-Aldrich
CXorf27, HIP17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003356
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003356, RRID:AB_1078593
Product name
Anti-CXorf27 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003356
Antibody type
Polyclonal
Antigen
Huntingtin-interacting protein HYPM recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPANIMSEKKNCKNSSTNNNQTQDPSRNELQVPRS
FVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIM
ERVGLEASNNGSMRNTSQDREREVDNNREPH
Storage
-20C
Provider Type Product Number
- No reagents -