Antibody data

Product number
H00006818-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006818-M01A, RRID:AB_1581107
Product name
SULT1A3 monoclonal antibody (M01A), clone 1B10
Provider product page
Abnova Corporation - H00006818-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SULT1A3.
Antigen sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQ
ARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKC
NRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLI
KSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYY
HFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQH
VQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF
VGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQ
ELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY
AEKMAGCSLSFRSEL
Isotype
IgG
Antibody clone number
1B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -