WH0001678M1

TIMM8A antibody from Sigma-Aldrich
DDP, DFN1, MTS
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0001678M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0001678M1, RRID:AB_1843951
Product name
Monoclonal Anti-TIMM8A antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0001678M1
Antibody type
Monoclonal
Antigen
TIMM8A (NP_004076, a.a. 9-98) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELC
WEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFIL
NRLEQTQKSKPVFSESLSD* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -