HPA019593

DAZL antibody from Sigma-Aldrich
DAZH, DAZL1, DAZLA, MGC26406, SPGYLA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019593
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019593, RRID:AB_1847494
Product name
Anti-DAZL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019593
Antibody type
Polyclonal
Antigen
Deleted in azoospermia-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSY
VVPPAYSAVNYHCNEVDPGAEVVPNECS
Storage
-20C
Provider Type Product Number
- No reagents -