Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN971363 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Programmed Cell Death 4 (Neoplastic Transformation Inhibitor) (PDCD4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PDCD4 antibody: synthetic peptide directed towards the N terminal of human PDCD4
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWIS
ASSIN EARINAKAKR- Vial size
- 50ug
Submitted references microRNA 21: response to hormonal therapies and regulatory function in leiomyoma, transformed leiomyoma and leiomyosarcoma cells.
miR-21: an oncomir on strike in prostate cancer.
A novel function of the MA-3 domains in transformation and translation suppressor Pdcd4 is essential for its binding to eukaryotic translation initiation factor 4A.
Pan Q, Luo X, Chegini N
Molecular human reproduction 2010 Mar;16(3):215-27
Molecular human reproduction 2010 Mar;16(3):215-27
miR-21: an oncomir on strike in prostate cancer.
Folini M, Gandellini P, Longoni N, Profumo V, Callari M, Pennati M, Colecchia M, Supino R, Veneroni S, Salvioni R, Valdagni R, Daidone MG, Zaffaroni N
Molecular cancer 2010 Jan 21;9:12
Molecular cancer 2010 Jan 21;9:12
A novel function of the MA-3 domains in transformation and translation suppressor Pdcd4 is essential for its binding to eukaryotic translation initiation factor 4A.
Yang HS, Cho MH, Zakowicz H, Hegamyer G, Sonenberg N, Colburn NH
Molecular and cellular biology 2004 May;24(9):3894-906
Molecular and cellular biology 2004 May;24(9):3894-906
No comments: Submit comment
No validations: Submit validation data