HPA024185

RBCK1 antibody from Sigma-Aldrich
C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024185
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024185, RRID:AB_1845673
Product name
Anti-RBCK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024185
Antibody type
Polyclonal
Antigen
RanBP-type and C3HC4-type zinc finger-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGF
PPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLY
LLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQP
RGPLEPGPPKPGVPQEPGRGQPDAVPEP
Storage
-20C
Provider Type Product Number
- No reagents -