Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487052 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SRY (Sex Determining Region Y)-Box 11 (SOX11) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SOX11 antibody: synthetic peptide directed towards the middle region of human SOX11
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
PHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSA
ESPEG ASLYDEVRAG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cis-regulatory control of corticospinal system development and evolution.
Nuclear expression of the non B-cell lineage Sox11 transcription factor identifies mantle cell lymphoma.
Shim S, Kwan KY, Li M, Lefebvre V, Sestan N
Nature 2012 May 30;486(7401):74-9
Nature 2012 May 30;486(7401):74-9
Nuclear expression of the non B-cell lineage Sox11 transcription factor identifies mantle cell lymphoma.
Ek S, Dictor M, Jerkeman M, Jirström K, Borrebaeck CA
Blood 2008 Jan 15;111(2):800-5
Blood 2008 Jan 15;111(2):800-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting