Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002308-M12 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002308-M12, RRID:AB_875590
- Product name
- FOXO1A monoclonal antibody (M12), clone 3A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FOXO1A.
- Antigen sequence
MSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQ
PNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSS
HTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRL- Isotype
- IgG
- Antibody clone number
- 3A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FOXO1A monoclonal antibody (M12), clone 3A10 Western Blot analysis of FOXO1A expression in SW-13 ( Cat # L005V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to FOXO1 on HeLa cell . [antibody concentration 15 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to FOXO1A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol