Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309640 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Forkhead Box O1 (FOXO1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FOXO1 antibody: synthetic peptide directed towards the C terminal of human FOXO1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
HPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDL
DGMFI ERLDCDMESI- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Phosphorylation regulates transcriptional activity of PAX3/FKHR and reveals novel therapeutic possibilities.
Amstutz R, Wachtel M, Troxler H, Kleinert P, Ebauer M, Haneke T, Oehler-Jänne C, Fabbro D, Niggli FK, Schäfer BW
Cancer research 2008 May 15;68(10):3767-76
Cancer research 2008 May 15;68(10):3767-76
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting