HPA001671

STAT3 antibody from Atlas Antibodies
APRF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001671
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001671, RRID:AB_611811
Product name
Anti-STAT3
Provider product page
Atlas Antibodies - HPA001671
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAE
IIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYC
RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI
DLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTF
DMELTSECA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -