Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182346 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon Regulatory Factor 9 (IRF9) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ISGF3G antibody: synthetic peptide directed towards the N terminal of human ISGF3G
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTG
GPAVW KTRLRCALNK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Silencing of Irf7 pathways in breast cancer cells promotes bone metastasis through immune escape.
Structural basis of core promoter recognition in a primitive eukaryote.
Role of metazoan mediator proteins in interferon-responsive transcription.
Bidwell BN, Slaney CY, Withana NP, Forster S, Cao Y, Loi S, Andrews D, Mikeska T, Mangan NE, Samarajiwa SA, de Weerd NA, Gould J, Argani P, Möller A, Smyth MJ, Anderson RL, Hertzog PJ, Parker BS
Nature medicine 2012 Aug;18(8):1224-31
Nature medicine 2012 Aug;18(8):1224-31
Structural basis of core promoter recognition in a primitive eukaryote.
Schumacher MA, Lau AO, Johnson PJ
Cell 2003 Nov 14;115(4):413-24
Cell 2003 Nov 14;115(4):413-24
Role of metazoan mediator proteins in interferon-responsive transcription.
Lau JF, Nusinzon I, Burakov D, Freedman LP, Horvath CM
Molecular and cellular biology 2003 Jan;23(2):620-8
Molecular and cellular biology 2003 Jan;23(2):620-8
No comments: Submit comment
No validations: Submit validation data