ABIN633169

antibody from antibodies-online

Targeting: MBL2 COLEC1, MBL

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633169 - Provider product page
Provider: antibodies-online
Product name: anti-Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

MBL2 protein structure - ABIN633169 shown in red.