H00003981-M01A

LIG4 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00003981-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003981-M01A, RRID:AB_1575683
Product name
LIG4 monoclonal antibody (M01A), clone 1A4
Provider product page
Abnova Corporation - H00003981-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant LIG4.
Antigen sequence
RYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGT
RLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSR
VADFKAFRRTFKRKFKILKESWVTDSIDKCELQEE
NQYLI
Isotype
IgG
Antibody clone number
1A4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -