PAB30613
antibody from Abnova Corporation
Targeting: SNAP25
bA416N4.2, dJ1068F16.2, RIC-4, RIC4, SEC9, SNAP, SNAP-25
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30613 - Provider product page
- Provider
- Abnova Corporation
- Product name
- SNAP25 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant human SNAP25.
- Antigen sequence
SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISG
GFIRRVTNDARENEMDENLEQVSGIIGNLRHMALD
MGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATK
MLGSG- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of human cerebral cortex tissue lysate with SNAP25 polyclonal antibody (Cat # PAB30613).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of mouse cerebral cortex tissue lysate with SNAP25 polyclonal antibody (Cat # PAB30613).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with SNAP25 polyclonal antibody (Cat # PAB30613).