H00011072-M03

DUSP14 antibody from Abnova Corporation
MKP-L, MKP6
No application information provided.

Antibody data

Product number
H00011072-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011072-M03, RRID:AB_1136924
Product name
DUSP14 monoclonal antibody (M03), clone 4F6
Provider product page
Abnova Corporation - H00011072-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant DUSP14.
Antigen sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLF
LGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQ
FEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHG
ATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNW
VKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQ
TPYGIVPDVYEKESRHLMPYWGI
Isotype
IgG
Antibody clone number
4F6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -