ABIN567460

TXNIP antibody from antibodies-online
ARRDC6, EST01027, HHCPA78, THIF, VDUP1

Antibody data

Product number
ABIN567460
Provider
antibodies-online
Product name
anti-Thioredoxin Interacting Protein (TXNIP) antibody
Provider product page
antibodies-online - ABIN567460
Antibody type
Polyclonal
Antigen
The immunogen for anti-TXNIP antibody: synthetic peptide directed towards the middle region of human TXNIP
Reactivity
Human
Host
Rabbit
Antigen sequence
VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPD
LMAPV SAKKEKKVSC
Vial size
50 µg
Provider Type Product Number
- No reagents -